Recombinant Human Rb Protein
Beta LifeScience
SKU/CAT #: BLA-7660P
Recombinant Human Rb Protein
Beta LifeScience
SKU/CAT #: BLA-7660P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | Exon 17 tumor GOS561 substitution mutation causes premature stop GOS563 exon 17 substitution mutation causes premature stop OSRC Osteosarcoma p105-Rb P105RB PP105 pp110 PPP1R130 pRb Prepro retinoblastoma associated protein Protein phosphatase 1 regulatory subunit 130 Rb RB transcriptional corepressor 1 RB_HUMAN RB1 RB1 gene Retinoblastoma 1 Retinoblastoma suspectibility protein Retinoblastoma-associated protein |
Description | Recombinant Human Rb Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGES FGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGS KHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH |
Molecular Weight | 17 kDa |
Purity | >95% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |