Recombinant Human RASSF1 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7653P
Recombinant Human RASSF1 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7653P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9NS23-2 |
Synonym | 123F2 Cardiac specific ras association domain family 1 protein cardiac-specific ras association domain family 1 protein, 123F2 NORE2A OTTHUMP00000195503 OTTHUMP00000195504 OTTHUMP00000195505 OTTHUMP00000195507 Pancreas specific ras association domain family 1 protein Ras association (RalGDS/AF 6) domain family member 1 Ras association domain-containing protein 1 RASF1_HUMAN Rassf1 RASSF1A RDA32 REH3P21 Tumor suppressor protein RDA32 WUGSC:H_LUCA12.5 |
Description | Recombinant Human RASSF1 Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSGEPELIELRELA PAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTW CDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPAVE RDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFI KVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHL HVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQ PLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEE HLRQILQKYSYCRQKIQEALHACPLG |
Molecular Weight | 43 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |