Recombinant Human Raptor Protein
Beta LifeScience
SKU/CAT #: BLA-7644P
Recombinant Human Raptor Protein
Beta LifeScience
SKU/CAT #: BLA-7644P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8N122-2 |
Synonym | KIAA1303 KOG1 Mip1 P150 target of rapamycin (TOR) scaffold protein p150 target of rapamycin (TOR) scaffold protein containing WD repeats P150 target of rapamycin (TOR)-scaffold protein Raptor Regulatory associated protein of mTOR Regulatory associated protein of MTOR complex 1 Regulatory-associated protein of mTOR RPTOR RPTOR_HUMAN |
Description | Recombinant Human Raptor Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWR MKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALE TIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHY NGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAG LIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATE LLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNF LLAERIMRSYNCTPVSSPRLPPTYMHAMW |
Molecular Weight | 68 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |