Recombinant Human Rap2A Protein
Beta LifeScience
SKU/CAT #: BLA-7642P
Recombinant Human Rap2A Protein
Beta LifeScience
SKU/CAT #: BLA-7642P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P10114 |
Synonym | K REV KREV RAP2 RAP2A RAP2A, member of RAS oncogene family RAP2A_HUMAN Ras-related protein Rap-2a RbBP 30 RbBP-30 RbBP30 |
Description | Recombinant Human Rap2A Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMREYKVVVLGSGGVGKSALTVQFVTGTFIE KYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFIL VYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSE GRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSAC |
Molecular Weight | 22 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |