Recombinant Human RAP1B Protein
Beta LifeScience
SKU/CAT #: BLA-7641P
Recombinant Human RAP1B Protein
Beta LifeScience
SKU/CAT #: BLA-7641P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P61224 |
Synonym | GTP-binding protein smg p21B K-REV OK/SW-cl.11 RAL1B rap1b RAP1B member of RAS oncogene family RAP1B_HUMAN Ras family small GTP binding protein RAP1B RAS related protein RAP1B Ras-related protein Rap-1b Small GTP binding protein |
Description | Recombinant Human RAP1B Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMREYKLVVLGSGGVGKSALTVQFVQGIFVE KYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFAL VYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQ GQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS C |
Molecular Weight | 23 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |