Recombinant Human RAP1 Protein
Beta LifeScience
SKU/CAT #: BLA-7637P
Recombinant Human RAP1 Protein
Beta LifeScience
SKU/CAT #: BLA-7637P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | Dopamine receptor interacting protein 5 Dopamine receptor-interacting protein 5 DRIP 5 DRIP5 hRap1 MGC105533 RAP 1 RAP1 homolog RAP1, yeast, homolog if RAP1, yeast, homolog of Repressor/activator protein 1 homolog TE2IP_HUMAN Telomeric Repeat Binding Factor 2 Interacting Protein Telomeric repeat-binding factor 2-interacting protein 1 TERF2-interacting protein TERF2-interacting telomeric protein 1 TERF2IP TRF2 Interacting Telomeric Protein RAP1 TRF2 interacting telomeric RAP1 protein TRF2-interacting telomeric protein TRF2-interacting telomeric protein 1 |
Description | Recombinant Human RAP1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGG GTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYR LGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKE NARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDA PVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAV KKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEE EEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFL ASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |