Recombinant Human RAP1 Protein
Beta LifeScience
SKU/CAT #: BLA-7637P
Recombinant Human RAP1 Protein
Beta LifeScience
SKU/CAT #: BLA-7637P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | Dopamine receptor interacting protein 5 Dopamine receptor-interacting protein 5 DRIP 5 DRIP5 hRap1 MGC105533 RAP 1 RAP1 homolog RAP1, yeast, homolog if RAP1, yeast, homolog of Repressor/activator protein 1 homolog TE2IP_HUMAN Telomeric Repeat Binding Factor 2 Interacting Protein Telomeric repeat-binding factor 2-interacting protein 1 TERF2-interacting protein TERF2-interacting telomeric protein 1 TERF2IP TRF2 Interacting Telomeric Protein RAP1 TRF2 interacting telomeric RAP1 protein TRF2-interacting telomeric protein TRF2-interacting telomeric protein 1 |
Description | Recombinant Human RAP1 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGG GTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYR LGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKE NARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDA PVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAV KKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEE EEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFL ASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |