Recombinant Human RALA Protein
Beta LifeScience
SKU/CAT #: BLA-7620P
Recombinant Human RALA Protein
Beta LifeScience
SKU/CAT #: BLA-7620P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P11233 |
Synonym | MGC48949 RAL Ral a Ral A protein RALA RALA_HUMAN Ras family small GTP binding protein RALA RAS like protein A Ras related protein RalA Ras-related protein Ral-A v ral simian leukemia viral oncogene homolog A v ral simian leukemia viral oncogene homolog A (ras related) |
Description | Recombinant Human RALA Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMAANKPKGQNSLALHKVIMVGSGGVG KSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYA AIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVG NKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIR ARKMEDSKEKNGKKKRKSLAKRIRERC |
Molecular Weight | 26 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |