Recombinant Human RAIDD Protein
Beta LifeScience
SKU/CAT #: BLA-7618P
Recombinant Human RAIDD Protein
Beta LifeScience
SKU/CAT #: BLA-7618P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P78560 |
Synonym | CASP2 and RIPK1 domain containing adaptor with death domain Caspase and RIP adapter with death domain Caspase and RIP adaptor with death domain Cradd CRADD_HUMAN Death adaptor molecule RAIDD Death domain containing protein CRADD Death domain-containing protein CRADD MGC9163 RIP associated ICH1/CED3 homologous protein with death domain RIP associated protein with a death domain RIP-associated protein with a death domain |
Description | Recombinant Human RAIDD Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQ TTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDL PAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYR CKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPS LLLHMLE |
Molecular Weight | 23 kDa |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |