Recombinant Human Rad6 Protein
Beta LifeScience
SKU/CAT #: BLA-7596P
Recombinant Human Rad6 Protein
Beta LifeScience
SKU/CAT #: BLA-7596P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P49459 |
Synonym | BHR6A hHR6A HR6A mHR6A MRXS30 MRXSN RAD6 homolog A RAD6A UBC2 UBCD6 UBE2A Ube2a ubiquitin-conjugating enzyme E2A UBE2A_HUMAN Ubiquitin carrier protein Ubiquitin carrier protein A Ubiquitin conjugating enzyme E2 17 kDa Ubiquitin conjugating enzyme E2 21.5 kDa Ubiquitin conjugating enzyme E2A Ubiquitin conjugating enzyme E2A (RAD6 homolog) Ubiquitin protein ligase A Ubiquitin-conjugating enzyme E2 A Ubiquitin-protein ligase A |
Description | Recombinant Human Rad6 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFED GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTY DVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWR DC |
Molecular Weight | 17 kDa including tags |
Purity | >95% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |