Recombinant Human Rad51D Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7593P
Recombinant Human Rad51D Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7593P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O75771-3. |
Synonym | BROVCA4 DNA repair protein RAD51 homolog 4 HsTRAD OTTHUMP00000163851 OTTHUMP00000163852 OTTHUMP00000163853 R51H3 RA51D_HUMAN RAD51 homolog D RAD51 homolog D (S. cerevisiae) RAD51 like 3 (S. cerevisiae) RAD51 paralog D RAD51, S. cerevisiae, homolog of, D RAD51-like protein 3 Rad51l3 Recombination repair protein S. cerevisiae RAD51-like 3 TRAD |
Description | Recombinant Human Rad51D Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHH SSGLVPRGSH MGSMGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSY KAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVT AVVSPLLGGQQREGLALMMQLARELKTLARDLGMAVVVTNHITRDRDSGR LKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEMV DIGTWGTSEQSATLQGDQT |
Molecular Weight | 26 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |