Recombinant Human RAC1 Protein

Beta LifeScience SKU/CAT #: BL-4459PS
Recombinant Human RAC1 Protein

Recombinant Human RAC1 Protein

Beta LifeScience SKU/CAT #: BL-4459PS
Catalog No.: BL-4459PS

Product Overview

Tag N/A
Host Species Human
Synonym P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, rho family small GTP binding protein Rac1, TC-25, MGC111543.
Background RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion.
Description RAC1 Human Recombinant expressed in E.Coli is a single, non-glycosylated polypeptide chain containing 192a.a. and having a molecular weight of 21.4 kDa.
Source E.coli
AA Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Purity >95.0% as determined by SDS-PAGE.
Endotoxin <1.0 EU per μg by the LAL method.
Formulation The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.
Stability Recombinant protein is stable for 12 months at -70°C
Usage For Research Use Only
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Recently viewed