Recombinant Human RAC1 Protein
Beta LifeScience
SKU/CAT #: BL-4459PS
Recombinant Human RAC1 Protein
Beta LifeScience
SKU/CAT #: BL-4459PS
Catalog No.: BL-4459PS
Product Overview
| Tag | N/A |
| Host Species | Human |
| Synonym | P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein, rho family small GTP binding protein Rac1, TC-25, MGC111543. |
| Background | RAC1 is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. RAC-1 regulates the actin cytoskeleton but also other cellular processes. RAC1 have been shown to be involved in the regulation of cell-cell adhesion. |
| Description | RAC1 Human Recombinant expressed in E.Coli is a single, non-glycosylated polypeptide chain containing 192a.a. and having a molecular weight of 21.4 kDa. |
| Source | E.coli |
| AA Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL. |
| Purity | >95.0% as determined by SDS-PAGE. |
| Endotoxin | <1.0 EU per μg by the LAL method. |
| Formulation | The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. |
| Stability | Recombinant protein is stable for 12 months at -70°C |
| Usage | For Research Use Only |
| Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
