Recombinant Human Rab4 Protein

Name: Recombinant Human Rab4 Protein
Brand: Beta LifeScience
SKU: BLA-7554P
Availability: InStock

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P20338
Synonym	HRES 1 / RAB4 Oncogene RAB4 Rab 4 RAB 4A RAB4 member RAS oncogene family Rab4a RAB4A member RAS oncogene family RAB4A_HUMAN Ras related protein Rab 4A Ras related protein Rab4A Ras-related protein Rab-4A
Description	Recombinant Human Rab4 Protein was expressed in E.coli. It is a Full length protein
Source	E.coli
AA Sequence	MGSSHHHHHHSSGLVPRGSHMSQTAMSETYDFLFKFLVIGNAGTGKSCLL HQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTR SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDL DADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES GELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Molecular Weight	27 kDa including tags
Purity	Greater than 90% SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Involved in protein transport. Plays a role in vesicular traffic. Mediates VEGFR2 endosomal trafficking to enhance VEGFR2 signaling. Acts as a regulator of platelet alpha-granule release during activation and aggregation of platelets.
Subcellular Location	Membrane; Peripheral membrane protein. Cytoplasm. Early endosome membrane; Peripheral membrane protein. Recycling endosome membrane; Peripheral membrane protein.
Protein Families	Small GTPase superfamily, Rab family
Database References	HGNC: 9781 OMIM: 179511 KEGG: hsa:5867 STRING: 9606.ENSP00000355651 UniGene: Hs.296169

Gene Functions References

These findings bring attention to the effects of C-terminal carboxylmethylation on RAB GTPases and provide a rationale for targeting ICMT in the treatment of metastatic cancer PMID: 28604748
The results contradict the model of feedback activation of Rab5 and instead indicate that Rbpt5 is recruited by both Rabex5 recognizing ubiquitylated cargo and by Rab4 to activate Rab5 in a feed-forward manner. PMID: 26430212
Rab4 expression is up-regulated by laminar shear stress, which contributed to improved vascular endothelial cell autophagy and function. PMID: 26716952
Together the findings indicate that Arl1 links Rab4-dependent formation of endosomal sorting domains with downstream assembly of adaptor protein complexes that constitute the endosomal sorting machinery. PMID: 24835460
HRES-1/Rab4 regulates autophagy through promoting the formation of LC3(+) autophagosomes and the preservation of mitochondria. PMID: 24404161
Data indicate that Rab4 regulates ether-a-go-go-related gene (hERG) channel density via neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2). PMID: 23792956
our findings suggest an evolutionarily conserved function of HDPTP-Rab4 in the regulation of endocytic trafficking, cell adhesion and migration. PMID: 22825871
TBC1D16 is a GTPase activating protein for Rab4A that regulates transferrin receptor recycling and EGFR trafficking and signaling. PMID: 23019362
Upregulated expression of rab4, rab5, rab7 and rab27 correlates with antemortem measures of cognitive decline in individuals with mild cognitive impairment and Alzheimer disease. PMID: 21669283
Thus down- or up-regulation of Rab4A expression or Rab4A function triggered inhibition or increase of procathepsin L secretion respectively. PMID: 21501115
Overexpression of Rab4 regulates angiotensin II type I receptor phosphorylation and sensitization. PMID: 20943774
Findings substantiate the notion that modulation of the temporal and spatial distribution of P-gp in cancer cells may be a valid therapeutic strategy to alleviate the MDR phenotype, and signal to Rab4 as a potential target. PMID: 20209493
These findings suggest that Rab14 and Rab4 act sequentially, together with RUFY1. PMID: 20534812
NDRG1 specifically interacts with constitutively active Rab4aQ67L mutant protein and not with GDP-bound Rab4aS22N mutant proving NDRG1 as a novel Rab4a effector PMID: 17786215
Rab coupling protein (RCP), a novel Rab4 and Rab11 effector protein PMID: 11786538
Data suggest that abnormal membrane recycling in Niemann-Pick type A and C lipid storage disease fibroblasts results from specific inhibition of rab4 function by excess cholesterol in early endosomes. PMID: 15292453
In contrast to Rab11, Rab4 is not involved in exocytosis PMID: 15689494
Rab4 specific residue His39 modulates the nucleotide binding pocket giving rise to a reduced rate for nucleotide hydrolysis and exchange PMID: 15907487
critical element that regulates epithelial sodium channel (ENaC) function by GTP-GDP recycling and concomitant changes in ENaC expression at the cell surface and in intracellular pool PMID: 16389071
The study suggests that Rab4 regulates the channel through multiple mechanisms that include protein-protein interaction, GTP/GDP exchange, and channel protein trafficking. PMID: 16413502
CT229 of Chlamydia trachomatis interacts with and recruits Rab4A to the inclusion membrane and therefore may play a role in regulating the intracellular trafficking or fusogenicity of the chlamydial inclusion. PMID: 16926431
Regulation of CD4 expression via recycling by HRES-1/RAB4 controls susceptibility to HIV infection PMID: 16935861
elevated [5HT](ex)"paralyzes" the translocation of SERT from intracellular locations to the plasma membrane by controlling transamidation and Rab4-GTP formation PMID: 18227069
Both phosphorylated and nonphosphorylated MOR internalize via Rab5-dependent pathway after agonist stimulation, and the phosphorylated and nonphosphorylated MORs recycle through distinct vesicular trafficking pathways mediated by Rab4 and Rab11. PMID: 18550774
Cyclic AMP-mediated phosphoinositide-3-kinase-independent activation of Rab4 facilitates Ntcp translocation in a hepatoma cell line. PMID: 18688880
oxytocin receptors localize in vesicles containing the Rab5 and Rab4 small GTPases PMID: 19126785
activation of mTOR causes the loss of TCRzeta in lupus T cells through HRES-1/Rab4-dependent lysosomal degradation. PMID: 19201859
conclude that a recycling pathway regulated by Rab4A is a critical effector of VEGFR1 during branching morphogenesis of the vasculature PMID: 19302266
Data show that within several minutes after initiating rapid endocytosis of B2ARs by the isoproterenol, bright "puffs" of locally increased surface fluorescence intensity representing discrete Rab4-dependent recycling events. PMID: 19369423
D-AKAP2 promotes accumulation of recycling proteins in the Rab4/Rab11-positive endocytic recycling compartment PMID: 19797056

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.