Recombinant Human Rab4 Protein
Beta LifeScience
SKU/CAT #: BLA-7554P
Recombinant Human Rab4 Protein
Beta LifeScience
SKU/CAT #: BLA-7554P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P20338 |
Synonym | HRES 1 / RAB4 Oncogene RAB4 Rab 4 RAB 4A RAB4 member RAS oncogene family Rab4a RAB4A member RAS oncogene family RAB4A_HUMAN Ras related protein Rab 4A Ras related protein Rab4A Ras-related protein Rab-4A |
Description | Recombinant Human Rab4 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSQTAMSETYDFLFKFLVIGNAGTGKSCLL HQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTR SYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDL DADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIES GELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |