Recombinant Human Rab3D Protein
Beta LifeScience
SKU/CAT #: BLA-7553P
Recombinant Human Rab3D Protein
Beta LifeScience
SKU/CAT #: BLA-7553P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O95716 |
Synonym | D2-2 Glioblastoma overexpressed GOV RAB 16 RAB16 Rab3d Rab3D upregulated with myeloid differentiation RAB3D, member RAS oncogene family RAB3D_HUMAN RAD3D Ras-related protein Rab-3D |
Description | Recombinant Human Rab3D Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGN SSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAG QERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQV ILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLV DVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC |
Molecular Weight | 26 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |