Recombinant Human RAB2B Protein
Beta LifeScience
SKU/CAT #: BLA-7538P
Recombinant Human RAB2B Protein
Beta LifeScience
SKU/CAT #: BLA-7538P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WUD1 |
Synonym | FLJ14824 GTP binding protein RAB2B GTP-binding protein RAB2B RAB2B RAB2B member RAS oncogene family RAB2B_HUMAN RAS family, member RAB2B ras related protein Rab 2B ras related protein Rab2B Ras-related protein Rab-2B |
Description | Recombinant Human RAB2B Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTGVGKSCLLLQF TDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYY RGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESR RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |