Recombinant Human RAB2B Protein
Beta LifeScience
SKU/CAT #: BLA-7538P
Recombinant Human RAB2B Protein
Beta LifeScience
SKU/CAT #: BLA-7538P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q8WUD1 |
Synonym | FLJ14824 GTP binding protein RAB2B GTP-binding protein RAB2B RAB2B RAB2B member RAS oncogene family RAB2B_HUMAN RAS family, member RAB2B ras related protein Rab 2B ras related protein Rab2B Ras-related protein Rab-2B |
Description | Recombinant Human RAB2B Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTGVGKSCLLLQF TDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIWDTAGQESFRSITRSYY RGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNKSDLESR RDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |