Recombinant Human RAB29 Protein
Beta LifeScience
SKU/CAT #: BLA-7537P
Recombinant Human RAB29 Protein
Beta LifeScience
SKU/CAT #: BLA-7537P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | DKFZp686P1051 Rab 7 like protein 1 RAB 7L Rab-7-like protein 1 RAB29 Rab7 like protein 1 RAB7 member RAS oncogene family like 1 RAB7L RAB7L_HUMAN Ras related protein Rab 7L1 Ras related protein Rab7L1 Ras-related protein Rab-29 Ras-related protein Rab-7L1 |
Description | Recombinant Human RAB29 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQ WSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQ RWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTG WTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSW SCC |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |