Recombinant Human RAB27B Protein
Beta LifeScience
SKU/CAT #: BLA-7536P
Recombinant Human RAB27B Protein
Beta LifeScience
SKU/CAT #: BLA-7536P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O00194 |
Synonym | C25KG Rab27b RAB27B member RAS oncogene family RAS associated protein RAB27B Ras related protein Rab 27b Ras related protein Rab27b Ras-related protein Rab-27B RB27B_HUMAN Small GTP binding protein rab27b |
Description | Recombinant Human RAB27B Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMTDGDYDYLIKLLALGDSGVGKTTFLYRYT DNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQER FRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVL IGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDL IMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC |
Molecular Weight | 27 kDa |
Purity | >90% SDS-PAGE.purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |