Recombinant Human Rab17 Protein
Beta LifeScience
SKU/CAT #: BLA-7527P
Recombinant Human Rab17 Protein
Beta LifeScience
SKU/CAT #: BLA-7527P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q9H0T7 |
Synonym | AW413472 FLJ12538 OTTHUMP00000164417 OTTHUMP00000202805 Rab 17 Rab17 RAB17 member RAS oncogene family RAB17_HUMAN Ras related protein Rab 17 Ras related protein Rab17 Ras-related protein Rab-17 |
Description | Recombinant Human Rab17 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAQAHRTPQPRAAPSQPRVFKLVLLGSGSV GKSSLALRYVKNDFKSILPTVGCAFFTKVVDVGATSLKLEIWDTAGQEKY HSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEEELHPGEVLVMLV GNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQEL LQRSDEEGQALRGDAAVALNKGPARQAKCCAH |
Molecular Weight | 26 kDa |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |