Recombinant Human RAB13 Protein
Beta LifeScience
SKU/CAT #: BLA-7524P
Recombinant Human RAB13 Protein
Beta LifeScience
SKU/CAT #: BLA-7524P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P51153 |
Synonym | Cell growth-inhibiting gene 4 protein GIG4 Growth inhibiting gene 4 protein RAB13 RAB13 member RAS oncogene family RAB13_HUMAN RAS associated protein RAB13 Ras related protein Rab13 Ras-related protein Rab-13 |
Description | Recombinant Human RAB13 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAKAYDHLFKLLLIGDSGVGKTCLIIRFAE DNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRG AMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRK VQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGN GNKPPSTDLKTCDKKNTNKC |
Molecular Weight | 25 kDa including tags |
Purity | Greater than 85% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |