Recombinant Human Quiescin Q6 Protein
Beta LifeScience
SKU/CAT #: BLA-7519P
Recombinant Human Quiescin Q6 Protein
Beta LifeScience
SKU/CAT #: BLA-7519P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | O00391 |
Synonym | FLJ34858 hQSOX Human quiescin (Q6) mRNA, partial cds Q6 QSCN6 QSOX1 QSOX1_HUMAN Quiescin Q6 Quiescin Q6 sulfhydryl oxidase 1 Skin sulfhydryl oxidase Sox Sulfhydryl oxidase 1 Sulfhydryl oxidase 1 precursor |
Description | Recombinant Human Quiescin Q6 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | KALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKN GSGAVFPVAGADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFF |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |