Recombinant Human Pyrophosphatase 1 Protein
Beta LifeScience
SKU/CAT #: BLA-7510P
Recombinant Human Pyrophosphatase 1 Protein
Beta LifeScience
SKU/CAT #: BLA-7510P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q15181 |
Synonym | cytosolic inorganic pyrophosphatase diphosphate phosphohydrolase inorganic diphosphatase Inorganic pyrophosphatase inorganic pyrophosphatase 1 IOPPP IPYR_HUMAN PP PP1 PPA1 PPase Pyp pyrophosphatase, inorganic, 1 Pyrophosphate phospho hydrolase Pyrophosphate phospho-hydrolase SID6-8061 |
Description | Recombinant Human Pyrophosphatase 1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMSGFSTEERAAPFSLEYRVFLKNEKG QYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKG KLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIG SKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVK RLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDH WKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTV PTDVDKWFHHQKN |
Molecular Weight | 35 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |