Recombinant Human PYK2 Protein
Beta LifeScience
SKU/CAT #: BLA-7505P
Recombinant Human PYK2 Protein
Beta LifeScience
SKU/CAT #: BLA-7505P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q14289 |
Synonym | CADTK CAK-beta CAKB CAKbeta Calcium regulated non receptor proline rich tyrosine kinase Calcium-dependent tyrosine kinase Cell adhesion kinase beta E430023O05Rik EC 2.7.10.2 FADK 2 FADK2 FAK2 FAK2_HUMAN Focal adhesion kinase 2 MGC124628 PKB Proline-rich tyrosine kinase 2 Protein kinase B Protein Tyrosine Kinase 2 Beta Protein-tyrosine kinase 2-beta PTK PTK2B PTK2B protein tyrosine kinase 2 beta PYK2 RAFTK RAFTK2 Related adhesion focal tyrosine kinase |
Description | Recombinant Human PYK2 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLL APKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMRE EDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDP MVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA |
Molecular Weight | 47 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |