Recombinant Human PYCR2 Protein
Beta LifeScience
SKU/CAT #: BLA-7500P
Recombinant Human PYCR2 Protein
Beta LifeScience
SKU/CAT #: BLA-7500P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 1810018M05Rik FLJ54750 Leftb OTTHUMP00000035614 P5C reductase 2 P5CR 2 P5CR2 P5CR2_HUMAN PYCR 2 PYCR2 Pyrroline 5 carboxylate reductase 2 Pyrroline 5 carboxylate reductase family member 2 Pyrroline 5 carboxylate reductase isoform Pyrroline-5-carboxylate reductase 2 RP4-559A3.4 |
Description | Recombinant Human PYCR2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGV NLTRSNKETVKHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVT ISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTHALVEDGQLLE QLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRR LAIQLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGF RSLLINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTL TPSSPGKLLTRSLALGGKKD |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |