Recombinant Human PU.1/Spi1 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7487P
Recombinant Human PU.1/Spi1 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7487P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P17947-2 |
Synonym | transcription factor spi1 31 kDa Transforming Protein 31 kDa-transforming protein cb1086 Hematopoietic transcription factor PU.1 OF oncogene spi1 PU.1 SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of SFPI1 si:by184l24.2 SPI 1 SPI 1 proto oncogene SPI A Spi1 SPI1_HUMAN Spleen focus forming virus (SFFV) proviral integration oncogene spi1 Spleen focus forming virus proviral integration oncogene spi1 Transcription factor PU.1 |
Description | Recombinant Human PU.1/Spi1 Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSMLQACKMEGFPLVPPQPSEDLVPYDTD LYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSV QPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP AQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFL LDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQ KMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH |
Molecular Weight | 34 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |