Recombinant Human PTGES2/Gbf1 Protein
Beta LifeScience
SKU/CAT #: BLA-7452P
Recombinant Human PTGES2/Gbf1 Protein
Beta LifeScience
SKU/CAT #: BLA-7452P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | A6NHH0 |
Synonym | C9orf15 FLJ14038 Gamma interferon activated transcriptional element binding factor 1 GATE binding factor 1 GBF 1 GBF1 Membrane associated prostaglandin E synthase 2 MGC11289 Microsomal prostaglandin E synthase 2 mPGES 2 mPGES-2 PGES2 PGES2_HUMAN Prostaglandin E synthase 2 Prostaglandin E synthase 2 truncated form PTGES 2 PTGES2 |
Description | Recombinant Human PTGES2/Gbf1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMKAVNEQGKEVTEFGNKYWLMLNEKEAQQV YGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFG AVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKD RPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAIT EASPAH |
Molecular Weight | 24 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |