Recombinant Human Psoriasin Protein
Beta LifeScience
SKU/CAT #: BLA-7440P
Recombinant Human Psoriasin Protein
Beta LifeScience
SKU/CAT #: BLA-7440P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P31151 |
Synonym | HID 5 Protein S100 A7 Protein S100-A7 PSOR 1 PSOR1 Psoriasin Psoriasin 1 Psoriasin1 S100 Calcium binding protein A7 S100 calcium-binding protein A7 S100A7 S100A7c S10A7_HUMAN |
Description | Recombinant Human Psoriasin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSNTQAERSIIGMIDMFHKYTRRDDKIDKP SLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLG DIATDYHKQSHGAAPCSGGSQ |
Molecular Weight | 14 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |