Recombinant Human Psoriasin Protein
Beta LifeScience
SKU/CAT #: BLA-7440P
Recombinant Human Psoriasin Protein
Beta LifeScience
SKU/CAT #: BLA-7440P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P31151 |
Synonym | HID 5 Protein S100 A7 Protein S100-A7 PSOR 1 PSOR1 Psoriasin Psoriasin 1 Psoriasin1 S100 Calcium binding protein A7 S100 calcium-binding protein A7 S100A7 S100A7c S10A7_HUMAN |
Description | Recombinant Human Psoriasin Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSNTQAERSIIGMIDMFHKYTRRDDKIDKP SLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLG DIATDYHKQSHGAAPCSGGSQ |
Molecular Weight | 14 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |