Recombinant Human PSMF1 Protein
Beta LifeScience
SKU/CAT #: BLA-7439P
Recombinant Human PSMF1 Protein
Beta LifeScience
SKU/CAT #: BLA-7439P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q92530 |
Synonym | hPI31 PI31 Proteasome (prosome macropain) inhibitor subunit 1 Proteasome inhibitor hP131 subunit Proteasome inhibitor PI31 subunit PSMB2 Psmf1 PSMF1_HUMAN RP23 402M7.5 RP4 545L17.1 |
Description | Recombinant Human PSMF1 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKK SELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQ VADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKAN VSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDP FGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIG TSPPGPNPDHLPPPGYDDMYL |
Molecular Weight | 30 kDa including tags |
Purity | =85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |