Recombinant Human PSME3 Protein
Beta LifeScience
SKU/CAT #: BLA-7436P
Recombinant Human PSME3 Protein
Beta LifeScience
SKU/CAT #: BLA-7436P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P61289 |
Synonym | 11S regulator complex gamma subunit 11S regulator complex subunit gamma Activator of multicatalytic protease subunit 3 Ki Ki antigen Ki nuclear autoantigen Ki, PA28 gamma PA28 gamma PA28g PA28gamma Proteasome (prosome, macropain) activator subunit 3 Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) Proteasome activator 28 gamma Proteasome activator 28 subunit gamma Proteasome activator complex subunit 3 Proteasome activator subunit 3 PSME3 PSME3_HUMAN REG GAMMA REG-gamma |
Description | Recombinant Human PSME3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMASLLKVDQEVKLKVDSFRERITSEAEDLV ANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLD GPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLI EKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVT LHDMILKNIEKIKRPRSSNAETLY |
Molecular Weight | 32 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |