Recombinant Human PSMB4 Protein
Beta LifeScience
SKU/CAT #: BLA-7425P
Recombinant Human PSMB4 Protein
Beta LifeScience
SKU/CAT #: BLA-7425P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P28070 |
Synonym | 26 kDa prosomal protein HN3 HsBPROS26 HSN3 Macropain beta chain Multicatalytic endopeptidase complex beta chain PROS-26 PROS26 Proteasome (prosome macropain) subunit beta type 4 Proteasome beta 4 subunit Proteasome beta chain Proteasome chain 3 Proteasome subunit beta 4 Proteasome subunit beta type 4 Proteasome subunit beta type-4 Proteasome subunit HsN3 PSB4_HUMAN PSMB 4 PSMB4 |
Description | Recombinant Human PSMB4 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMTQNPMVTGTSVLGVKFEGGVVIAADMLGS YGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGD GHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLG VAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYR DARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE |
Molecular Weight | 27 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |