Recombinant Human PSGL-1 Protein
Beta LifeScience
SKU/CAT #: BLA-7414P
Recombinant Human PSGL-1 Protein
Beta LifeScience
SKU/CAT #: BLA-7414P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q14242 |
Synonym | CD 162 CD162 CD162 antigen CLA Cutaneous lymphocyte associated associated antigen P selectin glycoprotein ligand 1 P selectin glycoprotein ligand 1 precursor P-selectin glycoprotein ligand 1 PSGL 1 PSGL-1 PSGL1 Selectin P ligand SELPL_HUMAN SELPLG |
Description | Recombinant Human PSGL-1 Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHENLYFQGGTRLQLWDTWADEAEKALGPLLAR DRRQATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAAR RSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVP TEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTG LEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEA TEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSV SSVTHKGIPMAASNLSVNYPVGAPDHISVKQC |
Molecular Weight | 35 kDa including tags |
Purity | >90% SDS-PAGE.The final product was refolded using temperature shift inclusion body refolding technology and chromatographically purified. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle. |