Recombinant Human PSG9 Protein
Beta LifeScience
SKU/CAT #: BLA-7412P
Recombinant Human PSG9 Protein
Beta LifeScience
SKU/CAT #: BLA-7412P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q00887 |
Synonym | pregnancy specific beta 1 glycoprotein (PSG) pregnancy specific beta 1 glycoprotein 11 pregnancy specific beta 1 glycoprotein 9 pregnancy specific beta 1 glycoprotein B Pregnancy-specific beta-1 glycoprotein B Pregnancy-specific beta-1-glycoprotein 11 Pregnancy-specific beta-1-glycoprotein 9 Pregnancy-specific glycoprotein 11 Pregnancy-specific glycoprotein 7 Pregnancy-specific glycoprotein 9 PS beta B PS-beta-B PS-beta-G-11 PS-beta-G-9 PS34 PSBG 9 PSBG-11 PSBG-9 PSG 9 PSG11 PSG7 PSG9 PSG9_HUMAN PSGII |
Description | Recombinant Human PSG9 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | EVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIV DGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREE IRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNG QSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSP GVKRPIENRILILPSVTRNETGPYQCEIQDRYGGLRSNPVILNVLYGPDL PRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQI TRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQSVDHHHHHH |
Molecular Weight | 46 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |