Recombinant Human PSCA Protein
Beta LifeScience
SKU/CAT #: BLA-7398P
Recombinant Human PSCA Protein
Beta LifeScience
SKU/CAT #: BLA-7398P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | PRO 232 PRO232 Prostate stem cell antigen |
Description | Recombinant Human PSCA Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVD DSQDYYVGKKNITCCDTDLCNAS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |