Recombinant Human PRX-2 Protein
Beta LifeScience
SKU/CAT #: BLA-7396P
Recombinant Human PRX-2 Protein
Beta LifeScience
SKU/CAT #: BLA-7396P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | Paired mesoderm homeobox protein 2 Paired related homeobox protein 2 paired-like homeobox gene 2 paired-like homeodomain protein PRX2 Paired-related homeobox protein 2 PMX2 Predicted NUP98/PRRX2 fusion protein Prrx2 PRRX2_HUMAN PRX 2 PRX-2 PRX2 |
Description | Recombinant Human PRX-2 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | TFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWFQNRRAKF RRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSW |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |