Recombinant Human PRSS3/Mesotrypsin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7392P
Recombinant Human PRSS3/Mesotrypsin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7392P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | NP_002762 |
Synonym | Brain trypsinogen Mesotrypsin Mesotrypsinogen MTG Pancreatic trypsinogen III Protease, serine, 3 Protease, serine, 4 (trypsin 4, brain) PRSS3 PRSS4 Serine protease 3 Serine protease 4 T9 TRY3 TRY3_HUMAN TRY4 Trypsin 3 Trypsin III Trypsin IV Trypsin-3 Trypsinogen 4 Trypsinogen 5 Trypsinogen IV |
Description | Recombinant Human PRSS3/Mesotrypsin Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHENLYFQGGEFELIVGGYTCEENSLPYQVSLN SGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAK IIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLIS GWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGG KDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDT IAANS |
Molecular Weight | 28 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |