Recombinant Human PRSS22 Protein
Beta LifeScience
SKU/CAT #: BLA-7389P
Recombinant Human PRSS22 Protein
Beta LifeScience
SKU/CAT #: BLA-7389P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9GZN4 |
Synonym | Brain specific serine protease 4 BSSP 4 BSSP4 hBSSP 4 MGC9599 Prosemin Protease serine 22 Protease serine S1 family member 22 PRSS 22 PRSS26 Serine protease 22 Serine protease 26 SP001LA Tryptase epsilon |
Description | Recombinant Human PRSS22 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTS RWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVY SWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGS IQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLE GERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHR SWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARSHHHHHH |
Molecular Weight | 32 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |