Recombinant Human PRRG4 Protein
Beta LifeScience
SKU/CAT #: BLA-7385P
Recombinant Human PRRG4 Protein
Beta LifeScience
SKU/CAT #: BLA-7385P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 9930111I18Rik MGC117538 Proline-rich gamma-carboxyglutamic acid protein 4 Proline-rich Gla protein 4 PRRG 4 PRRG4 TMG4 TMG4_HUMAN Transmembrane gamma-carboxyglutamic acid protein 4 |
Description | Recombinant Human PRRG4 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRL LYNRFDLELFTPGNLERECNEELCNYEEAREIFVDEDKTIAFWQEYSAKG PTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLCITKCNRLQHPC SSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHS VSPPPPYPGHTKGFRVFKKSMSLPSH |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |