Recombinant Human PRRG4 Protein
Beta LifeScience
SKU/CAT #: BLA-7385P
Recombinant Human PRRG4 Protein
Beta LifeScience
SKU/CAT #: BLA-7385P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | 9930111I18Rik MGC117538 Proline-rich gamma-carboxyglutamic acid protein 4 Proline-rich Gla protein 4 PRRG 4 PRRG4 TMG4 TMG4_HUMAN Transmembrane gamma-carboxyglutamic acid protein 4 |
Description | Recombinant Human PRRG4 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MFTLLVLLSQLPTVTLGFPHCARGPKASKHAGEEVFTSKEEANFFIHRRL LYNRFDLELFTPGNLERECNEELCNYEEAREIFVDEDKTIAFWQEYSAKG PTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLCITKCNRLQHPC SSAVYERGRHTPSIIFRRPEEAALSPLPPSVEDAGLPSYEQAVALTRKHS VSPPPPYPGHTKGFRVFKKSMSLPSH |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |