Recombinant Human PRPS2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7383P
Recombinant Human PRPS2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-7383P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P11908 |
Synonym | EC 2.7.6.1 Phosphoribosyl pyrophosphate synthase II phosphoribosyl pyrophosphate synthetase 2 Phosphoribosyl pyrophosphate synthetase II PPRibP Prps2 PRPS2_HUMAN PRS II PRS-II Ribose phosphate pyrophosphokinase II Ribose-phosphate pyrophosphokinase 2 |
Description | Recombinant Human PRPS2 Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFPNIVLFSGSSHQDLSQRVADR LGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLI MINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGAD HIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDA GGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDM ADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVT NTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL |
Molecular Weight | 38 kDa including tags |
Purity | >90% SDS-PAGE.Expressed in E.coli as inclusion bodies. The final product was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |