Recombinant Human PRPF31 Protein
Beta LifeScience
SKU/CAT #: BLA-7378P
Recombinant Human PRPF31 Protein
Beta LifeScience
SKU/CAT #: BLA-7378P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8WWY3 |
Synonym | DKFZp566J153 hPrp 31 hPrp31 NY BR 99 Pre mRNA processing factor 31 Pre mRNA processing factor 31 homolog Pre mRNA processing factor 31 homolog (yeast) Pre-mRNA-processing factor 31 Precursor mRNA-processing factor 31, S. cerevisiae, homolog of Protein 61K PRP 31 PRP31 PRP31 pre mRNA processing factor 31 homolog PRP31 pre mRNA processing factor 31 homolog (yeast) PRP31_HUMAN PRPF 31 prpf31 RP 11 RP11 Serologically defined breast cancer antigen NY BR 99 Serologically defined breast cancer antigen NY-BR-99 SNRNP61 U4/U6 small nuclear ribonucleoprotein Prp31 U4/U6 snRNP 61 kDa protein |
Description | Recombinant Human PRPF31 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKT IAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLT VEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCK NNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNAS KHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIM LLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCT LAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQ RKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTAS SVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST |
Molecular Weight | 82 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |