Recombinant Human Prothrombin Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7372P
Recombinant Human Prothrombin Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7372P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P00734 |
Synonym | Coagulation factor II coagulation factor II (thrombin) F2 Factor II Prepro coagulation factor II Prothrombin prothrombin B-chain PT RPRGL2 serine protease THPH1 THRB THRB_HUMAN Thrombin heavy chain |
Description | Recombinant Human Prothrombin Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MTFGSGEADCGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGMSP WQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRI GKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSD YIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVV NLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKS PFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE |
Molecular Weight | 34 kDa |
Purity | >80% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |