Recombinant Human Proteasome subunit alpha type 6 Protein
Beta LifeScience
SKU/CAT #: BLA-7359P
Recombinant Human Proteasome subunit alpha type 6 Protein
Beta LifeScience
SKU/CAT #: BLA-7359P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P60900 |
Synonym | 27 kDa prosomal protein IOTA Macropain iota chain Macropain subunit iota MGC22756 MGC2333 MGC23846 Multicatalytic endopeptidase complex iota chain p27K PROS 27 PROS-27 PROS27 Prosomal P27K protein Proteasome (prosome macropain) subunit alpha type 6 Proteasome iota chain Proteasome subunit alpha type 6 Proteasome subunit alpha type-6 Proteasome subunit iota PSA6_HUMAN PSMA 6 PSMA6 |
Description | Recombinant Human Proteasome subunit alpha type 6 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMSRGSSAGFDRHITIFSPEGRLYQVE YAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENI GCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYT QNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTEST SFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPK FRILTEAEIDAHLVALAERD |
Molecular Weight | 30 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |