Recombinant Human Proteasome 20S LMP7 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7357P
Recombinant Human Proteasome 20S LMP7 Protein (denatured)
Beta LifeScience
SKU/CAT #: BLA-7357P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P28062 |
Synonym | ALDD D6S216 D6S216E Large multifunctional peptidase 7 Large multifunctional protease 7 LMP 7 LMP7 Low molecular mass protein 7 Low molecular weight protein 7 Macropain subunit C13 MGC1491 Multicatalytic endopeptidase complex subunit C13 NKJO OTTHUMP00000062981 Protease component C13 Proteasome (prosome macropain) subunit beta type 8 Proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) Proteasome beta 8 subunit Proteasome catalytic subunit 3i Proteasome component C13 Proteasome related gene 7 Proteasome subunit beta 5i Proteasome subunit beta 8 Proteasome subunit beta type Proteasome subunit beta type 8 Proteasome subunit beta type-8 Proteasome subunit beta-5i Proteasome subunit Y2 PSB8_HUMAN PSMB 8 PSMB5i PSMB8 Really interesting new gene 10 protein RING 10 RING10 Y2 |
Description | Recombinant Human Proteasome 20S LMP7 Protein (denatured) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMGSHMTTTLAFKFQHGVIAAVDSRASAGSY ISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERIS VSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNM FSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVN MYHMKEDGWVKVESTDVSDLLHQYREANQ |
Molecular Weight | 25 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |