Recombinant Human Proteasome 20S beta 3 Protein
Beta LifeScience
SKU/CAT #: BLA-7352P
Recombinant Human Proteasome 20S beta 3 Protein
Beta LifeScience
SKU/CAT #: BLA-7352P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P49720 |
Synonym | C10 II HC10 II proteasome (prosome, macropain) subunit, beta type 3 Proteasome beta 3 subunit Proteasome chain 13 proteasome component C10 II Proteasome component C10-II Proteasome subunit beta type-3 Proteasome theta chain PSB3_HUMAN PSMB3 |
Description | Recombinant Human Proteasome 20S beta 3 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCVAIAADRRFGI QAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGR QIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCP MVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD |
Molecular Weight | 25 kDa including tags |
Purity | Greater than 90% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |