Recombinant Human Prohibitin Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-7317P
Recombinant Human Prohibitin Protein (BSA and azide free)
Beta LifeScience
SKU/CAT #: BLA-7317P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P35232 |
Synonym | Epididymis luminal protein 215 Epididymis secretory sperm binding protein Li 54e HEL 215 HEL S 54e PHB PHB_HUMAN PHB1 Prohibitin |
Description | Recombinant Human Prohibitin Protein (BSA and azide free) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MKHHHHHHASMAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNI TLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELI TQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQ QEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
Molecular Weight | 31 kDa including tags |
Purity | Greater than 90% Densitometry. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |