Recombinant Human PRMT6 Protein
Beta LifeScience
SKU/CAT #: BLA-7298P
Recombinant Human PRMT6 Protein
Beta LifeScience
SKU/CAT #: BLA-7298P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | Q96LA8 |
Synonym | ANM6_HUMAN Chromobox protein homolog 7 FLJ10559 FLJ51477 Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 6 Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 Histone-arginine N-methyltransferase PRMT6 HMT1 hnRNP methyltransferase like 6. HRMT1L6 OTTHUMP00000012633 PRMT 6 prmt6 Protein arginine methyltransferase 6 Protein arginine N methyltransferase 6 Protein arginine N-methyltransferase 6 |
Description | Recombinant Human PRMT6 Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYEC YSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFC AQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVD AIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQM LEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARP QRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNP RRLRVLLRYKVGDQEEKTKDFAMED |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | The specific activity ofthis protein was1.4nmol/min/mg in amethyltransferase assay usinghistone H3 peptide (1-21) as substrate. |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |