Recombinant Human PRH1 + PRH2 Protein
Beta LifeScience
SKU/CAT #: BLA-7278P
Recombinant Human PRH1 + PRH2 Protein
Beta LifeScience
SKU/CAT #: BLA-7278P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | PRH1 Db-s DKFZp686B01256 DKFZp686F14256 DKFZp686I11251 DKFZp686J06255 DKFZp686L01253 DKFZp686L16244 DKFZp686M04243 DKFZp686N24248 Pa Parotid acidic protein Parotid double-band protein Parotid isoelectric focusing variant protein Parotid proline-rich protein 1/2 PIF-S Pr1/Pr2 PRH2 Protein C PRP-1/PRP-2 Salivary acidic proline-rich phosphoprotein 1/2 |
Description | Recombinant Human PRH1 + PRH2 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPP LGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGH PPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPP PQGGRPQGPPQGQSPQ |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |