Recombinant Human Presenilin 1/PS-1 Protein
Beta LifeScience
SKU/CAT #: BLA-7277P
Recombinant Human Presenilin 1/PS-1 Protein
Beta LifeScience
SKU/CAT #: BLA-7277P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P49768-2 |
Synonym | AD3 Ad3h FAD Homo Sapiens Clone CC44 Senilin 1 Presenilin-1 CTF12 Protein S182 PS 1 PS-1 PS1-CTF12 PSEN1 PSN1_HUMAN PSNL1 S182 |
Description | Recombinant Human Presenilin 1/PS-1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | PALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDD GGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGL |
Molecular Weight | 37 kDa including tags |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |