Recombinant Human PRDC Protein
Beta LifeScience
SKU/CAT #: BLA-7265P
Recombinant Human PRDC Protein
Beta LifeScience
SKU/CAT #: BLA-7265P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Synonym | BMP antagonist 2 CKTSF1B2 Cysteine knot superfamily 1 Cysteine knot superfamily 1 BMP antagonist 2 DAN domain family member 3 DAND 3 DAND3 GREM 2 Grem2 GREM2_HUMAN Gremlin 2 Gremlin 2 cysteine knot superfamily homolog Gremlin-2 Gremlin2 PRDC Protein related to DAN and cerberus |
Description | Recombinant Human PRDC Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYKDGSSNNSERWQHQIK EVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCCGQ CNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQ KVKQCRCMSVNLSDSDKQ |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |