Recombinant Human PRAME Protein
Beta LifeScience
SKU/CAT #: BLA-7258P
Recombinant Human PRAME Protein
Beta LifeScience
SKU/CAT #: BLA-7258P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P78395 |
Synonym | 4930534P07Rik Cancer/testis antigen 130 CT130 MAPE Melanoma antigen preferentially expressed in tumors OIP 4 OIP-4 OIP4 OPA interacting protein 4 Opa interacting protein OIP4 OPA-interacting protein 4 PRAME PRAME_HUMAN Preferentially expressed antigen in melanoma Preferentially expressed antigen of melanoma RP23-250F8.3 |
Description | Recombinant Human PRAME Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQ ALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI |
Molecular Weight | 11 kDa |
Purity | >98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |