Recombinant Human PRADC1 Protein
Beta LifeScience
SKU/CAT #: BLA-7255P
Recombinant Human PRADC1 Protein
Beta LifeScience
SKU/CAT #: BLA-7255P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9BSG0 |
Synonym | C2orf7 hPAP21 MGC13004 PADC1_HUMAN PAP21 Pradc1 Protease associated domain containing 1 Protease-associated domain-containing protein 1 Protease-associated domain-containing protein of 21 kDa |
Description | Recombinant Human PRADC1 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPP EACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDN DSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVN VTSIPTFELLQPPWTFWVDHHHHHH |
Molecular Weight | 20 kDa including tags |
Purity | >95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C. |