Recombinant Human PR3 Protein
Beta LifeScience
SKU/CAT #: BLA-7254P
Recombinant Human PR3 Protein
Beta LifeScience
SKU/CAT #: BLA-7254P
Collections: Other recombinant proteins, Recombinant proteins
Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
Host Species | Human |
Accession | P24158 |
Synonym | ACPA AGP 7 AGP7 AGP7 serine proteinase Azurophil Granule Protein 7 C ANCA C ANCA antigen C-ANCA antigen CANCA EC 3.4.21.76 Leukocyte proteinase 3 MBN MBT MBT WEGENER AUTOANTIGEN Myeloblastin Neutrophil proteinase 4 NP 4 NP-4 NP4 P29 PR 3 PR-3 PR3 Proteinase 3 Proteinase3 PRTN 3 Prtn3 PRTN3_HUMAN Serine proteinase neutrophil Wegener granulomatosis autoantigen Serine proteinase, neutrophil Wegener autoantigen Wegener granulomatosis autoantigen |
Description | Recombinant Human PR3 Protein was expressed in HEK293. It is a Full length protein |
Source | HEK293 |
AA Sequence | AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRD IPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS SPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNV TVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCA TRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH |
Molecular Weight | 26 kDa including tags |
Purity | >95% SDS-PAGE.Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |