Recombinant Human PPCS Protein
Beta LifeScience
SKU/CAT #: BLA-7216P
Recombinant Human PPCS Protein
Beta LifeScience
SKU/CAT #: BLA-7216P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9HAB8 |
Synonym | COAB FLJ11838 MGC117357 MGC138220 OTTHUMP00000008433 Phosphopantothenate--cysteine ligase Phosphopantothenoylcysteine synthetase PPC synthetase Ppcs PPCS_HUMAN RP11-163G10.1 |
Description | Recombinant Human PPCS Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MGSSHHHHHHSSGLVPRGSHMAEMDPVAEFPQPPGAARWAEVMARFAARL GAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGV LFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAE ALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLL SEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN |
Molecular Weight | 36 kDa including tags |
Purity | >95% SDS-PAGE.Purified by using conventional chromatography. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |